PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.H00907.1.p
Common NameEUGRSUZ_H00907
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 277aa    MW: 31212.6 Da    PI: 6.7746
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.H00907.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.77.5e-202269148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd ll++ vk +G g+W+++ar+ g++Rt+k+c++rw++yl
  Eucgr.H00907.1.p 22 KGPWTAEEDALLANHVKIHGEGRWNLVARRAGLKRTGKSCRLRWLNYL 69
                      79********************************************97 PP

2Myb_DNA-binding48.22.5e-1575118146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg++T eE++l+++++ ++G++ W++Ia+ ++ gRt++++k++w++
  Eucgr.H00907.1.p  75 RGNMTLEEQLLILELHCRWGNR-WSKIAQLLP-GRTDNEVKNYWRT 118
                       89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.6991773IPR017930Myb domain
SuperFamilySSF466897.49E-3119116IPR009057Homeodomain-like
SMARTSM007173.9E-172171IPR001005SANT/Myb domain
PfamPF002494.2E-182269IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-232376IPR009057Homeodomain-like
CDDcd001675.30E-132469No hitNo description
SMARTSM007171.8E-1274122IPR001005SANT/Myb domain
PROSITE profilePS5129417.67474124IPR017930Myb domain
PfamPF002495.9E-1475118IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-2177122IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MRSQYDSPSS VRTEEVTSDV RKGPWTAEED ALLANHVKIH GEGRWNLVAR RAGLKRTGKS  60
CRLRWLNYLR PDLRRGNMTL EEQLLILELH CRWGNRWSKI AQLLPGRTDN EVKNYWRTRV  120
QKLAKHLKCD VNSKQFRDTM RCVWMPRFME QIRASTGQFR ASAQGPSDRP AEDPPRTHGI  180
GSGYPVYDDH RDSLPELSSS VSSSDSSDPR FSSSPSPNQA GGIGSECFGL GSGDGPNYWT  240
GCAQWWQPGV DAGEQEDSNG CLVGEDSLES LWNEEDA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-26191224106B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.H00907.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010069752.10.0PREDICTED: transcription factor MYB108-like
TrEMBLA0A059AW270.0A0A059AW27_EUCGR; Uncharacterized protein (Fragment)
STRINGPOPTR_0002s19250.19e-79(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47190.18e-79myb domain protein 2